PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2748_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family bZIP
Protein Properties Length: 358aa    MW: 40563.5 Da    PI: 6.9592
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2748_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.3e-15275327557
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                    +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk+++ el+++ a
  Neem_2748_f_1 275 RRQRRMIKNRESAARSRARKQAYTVELELELTQLKEENEQLKQTVMELEQKRA 327
                    69***********************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-11271335IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634273325IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.19E-11275325No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-14275328No hitNo description
CDDcd147072.64E-22275316No hitNo description
PfamPF001703.7E-13275327IPR004827Basic-leucine zipper domain
PROSITE patternPS000360278293IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010152Biological Processpollen maturation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MALSDSVSVG YGGGEPESPH QTPKSPKDQA SSPLDRQNSI FSLTLDEIQL KSGRNFGSMN  60
MDEFLTNLWN VDENQVSSQS PPNQSELQPI NDNNVIQTDP PTLTRQNSFS IPIQICKKTL  120
DEVWSEIQKN VSMDNIISNH KPLERQQTFG EITLEEFLIK AGVVQEPTTT PKSLSQQQKV  180
DRQPIQINNI NNNTCLDASF DMEPNSMIAL AFSTHQNVGN DLLVNKAYGA YPIYTLTNTN  240
IVENDKSTHG VLETSGVKNN RKRIIDGPLE MVVERRQRRM IKNRESAARS RARKQAYTVE  300
LELELTQLKE ENEQLKQTVM ELEQKRAQEI FKRNKQSKMA RKKGENLKTL SRTTSSGW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015839.11e-117Basic-leucine zipper transcription factor family protein, putative
TrEMBLA0A061GVK61e-117A0A061GVK6_THECC; Basic-leucine zipper transcription factor family protein, putative
TrEMBLA0A0B0PST61e-117A0A0B0PST6_G
STRINGPOPTR_0009s16610.17e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.16e-59bZIP family protein